Meine Angaben sind natürlich nur Beispielangaben und ihr müsst diese natürlich durch Eure gewünschten Ports und IP Adressen ändern. LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); } var count = 0;   You cannot paste images directly. { } // console.log(key); }, ] This article describes how to configure port forwarding on a Fritz!Box 3490 router. } "action" : "rerender" lithstudio: [], { LITHIUM.Dialog.options['1329985427'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Die meisten von Euch möchten wahrscheinlich den unbeliebten Status bei Online Games NAT Typ Strikt los werden. "dialogKey" : "dialogKey" ] "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName", "context" : "", Since the FRITZ!Box establishes and controls its own internet connection over the fiber optic modem, all FRITZ!Box functions (such as internet telephony, firewall) are also available without restriction in … //$(window).scroll(function() { Archive View Return to standard view. }, "event" : "QuickReply", ], "initiatorBinding" : true, "event" : "ProductAnswer", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_64d3e2a1863325","nodesModel":{"Endgeraete|category":{"title":"Kategorie-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"ArchivKIP|forum-board":{"title":"Board-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_64d3e2a1863325_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { { "parameters" : { "forceSearchRequestParameterForBlurbBuilder" : "false", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612420,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Weiterleiten von Ports an einer FRITZ! { September 2016 Keine Kommentare vorhanden . }, ] { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ else { }, { } "event" : "approveMessage", }, } ] window.location = "https://forum.vodafone.de/t5/Archiv-Internet-Ger%C3%A4te/Fritzbox-6490-Port-Forwarding-broken/td-p/1612420" + "/page/" + 1; { "event" : "addThreadUserEmailSubscription", ] watching = true; 1 Log into your FRITZ!Box with your username and password. LITHIUM.Loader.runJsAttached(); ] "context" : "", "disableLinks" : "false", watching = true; Execute whatever should happen when entering the right sequence 5.0/6 Votes: 1; 5.0/6 Votes: 1. Setting up a GSM Gateway on a FRITZ!Box with a mobile broadband modem USB stick can be easily done because this is a standard feature of the latest FRITZ!Box models, beginning with the 72XX series and higher. Fastest FRITZ BOX SL Router Port Forwarding Steps. ] }, ] LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", The FRITZ!Box routers have a very similar interface. element.find('li').removeClass('active'); { } "kudosable" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "action" : "pulsate" "context" : "", { { "context" : "", element.addClass('active'); Its not working. } "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "useCountToKudo" : "false", "showCountOnly" : "false", { { I think once you get into pfSense you will get an upgrade later on, I started with a j3455 board and ended up with an i3-7100 as my main router, it can do a lot for your network. "dialogContentCssClass" : "lia-panel-dialog-content", { count = 0; { ] "revokeMode" : "true", if ( neededkeys[count] == key ) { LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" { { "actions" : [ }, resetMenu(); ;(function($) { "showCountOnly" : "false", "event" : "approveMessage", "event" : "unapproveMessage", { "action" : "rerender" Expertenansicht aktivieren: Einstellungen -> System -> Ansicht: Expertenansicht aktivieren. } "displayStyle" : "horizontal", "action" : "rerender" "action" : "pulsate" "context" : "envParam:quiltName,message", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "action" : "rerender" }); if ( !watching ) { Why port forwarding feature is not working on my router? ] "action" : "pulsate" }, "truncateBody" : "true", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); die Anwendung alle von ihr benötigten Portfreigaben selbstständig in der FRITZ!Box einrichten soll. "event" : "MessagesWidgetEditAction", "event" : "QuickReply", ] window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":496,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PBFNUDlEBBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRVAVVBAFVAhQCUVBWSQEFUAVIDldbAE8DAlRQUQ0LBwZXAQZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "action" : "rerender" } "action" : "rerender" }, "action" : "rerender" "context" : "", return; { "useTruncatedSubject" : "true", '; "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "actions" : [ Since they promise the UXG line will be able to do everything the USG can do, they have a lot of work to do. { "action" : "rerender" { } ] Note: Your post will require moderator approval before it will be visible. "context" : "", LITHIUM.Dialog.options['274251699'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Aktivieren Sie UPnP in Ihrer FritzBox, kann spezielle Software auf Ihrem PC beliebige Ports in der FritzBox freigeben. window.location.replace('/t5/user/userloginpage'); "actions" : [ I am convinced with his feedback. { }, "context" : "", $(document).ready(function(){ "context" : "envParam:quiltName", } LITHIUM.Dialog.options['826786465'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; $(document).ready(function() { { "event" : "approveMessage", "action" : "rerender" { "quiltName" : "ForumMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_64d3e2a867453d","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", } "actions" : [ "actions" : [ window.location.replace('/t5/user/userloginpage'); ', 'ajax'); "}); { "action" : "rerender" { LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "action" : "rerender" $(document).ready(function(){ ] "buttonDialogCloseAlt" : "Schließen", "truncateBodyRetainsHtml" : "false", }, ] "context" : "", if ( watching ) { element.siblings('li').children('ul').slideUp(); }, 4 Click on the "New Port Forwarding" button. I have also tried to expose the entire host, no success. "accessibility" : false, { }); "context" : "", { } { { ] } "action" : "rerender" User Application Requirement. } Whirlpool. "context" : "", "action" : "pulsate" "event" : "kudoEntity", } "actions" : [ } ] "useTruncatedSubject" : "true", }, })(LITHIUM.jQuery); "parameters" : { { { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", if(1 < 1){ Aim of this article: This article describes how to configure port forwarding on a Fritz!Box 3490 router. } LITHIUM.Dialog.options['274251699'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }); "componentId" : "forums.widget.message-view", ipv6 is also not the same as ipv4. var notifCount = 0; "event" : "MessagesWidgetEditCommentForm", "event" : "ProductMessageEdit", ; Name: enter a name of your choice for the port sharing rule; Protocol: select the IP protocol (TCP, UDP, ESP or GRE) required by the server service or application from the drop-down.. "dialogKey" : "dialogKey" "buttonDialogCloseAlt" : "Schließen", Bist du sicher, dass du fortfahren möchtest? UPnP bei Fritzbox-Routern aktivieren. "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'e9Sd4WuLDg-ZzoqaUCHeG6cxEHvbSV6sU1WQg86WotA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ', 'ajax'); ] "action" : "rerender" "useSimpleView" : "false", Were the hints from thomasschaefer helpful? // Reset the conditions so that someone can do it all again. $('li.close-on-click').on('click',resetMenu); "useSubjectIcons" : "true", { "event" : "kudoEntity", }, ] { { "action" : "rerender" ], { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); A new window will appear asking you to configure the rule. "displayStyle" : "horizontal", "initiatorDataMatcher" : "data-lia-message-uid" })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612420,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "actions" : [ ] } Well i have an ISP issued router: Fritz!Box 6490 Cable (germany) and i have a ton of Problems with port forwarding. "context" : "envParam:quiltName", "actions" : [ } "initiatorBinding" : true, { "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'f14bW1KiNrp2NJYl_qb0gekky-O-9OBApolcWzS4vQU. { "componentId" : "kudos.widget.button", "event" : "addThreadUserEmailSubscription", "event" : "QuickReply", }, "event" : "MessagesWidgetEditAction", { You created a backup file with this FRITZ!Box or with a different FRITZ!Box. "event" : "removeMessageUserEmailSubscription", { } "event" : "MessagesWidgetEditCommentForm", } ;(function($) { { "context" : "envParam:entity", "actions" : [ LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); "initiatorDataMatcher" : "data-lia-kudos-id" .attr('aria-expanded','true'); $('.js-close-header-announcement').on('click', clickHandler); Login to your FRITZ BOX Fon WLAN 7570 router. // If watching, pay attention to key presses, looking for right sequence. "event" : "addMessageUserEmailSubscription", "selector" : "#kudosButtonV2_0", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eJe205bSQBUJkHfbax9CPOGUvsxMk66wQHKH-7hE6kw. "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "context" : "envParam:quiltName,product,contextId,contextUrl", } } }, Internet / Permit Access / Port Sharing (or Port Forwarding) All of the devices in the home network are protected from unauthorized access from the internet by the FRITZ!Box firewall. ], "context" : "lia-deleted-state", { { ] "context" : "envParam:entity", ] }, { }, "message" : "1614426", }, { } { "actions" : [ }, "action" : "rerender" { watching = false; LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "entity" : "1614426", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1614426 .lia-rating-control-passive', '#form_1'); } "action" : "pulsate" { "event" : "MessagesWidgetEditAnswerForm", count = 0; "actions" : [ "actions" : [ { } window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":496,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PBFNUDlEBBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRVAVVBAFVAhQCUVBWSQEFUAVIDldbAE8DAlRQUQ0LBwZXAQZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}. "actions" : [ }, "initiatorBinding" : true, "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" }, "context" : "envParam:feedbackData", ] "action" : "pulsate" }); { I had the same problem today, but this time, the port forward didn't work anymore. Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TQ2SXUsVOb7FpoOQcwo6wOVoLcD2xaghhEwUJEOYAVk. }); 876 Postings, noch 24 bis zum nächsten Level (900) Postings: 876. { "event" : "editProductMessage", { }); "actions" : [ "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] }, "includeRepliesModerationState" : "false", I have a problem. ] Bist du sicher, dass du fortfahren möchtest? { } Got a new Fritzbox 6490 - can't port forward SSH to my home server ‎01.03.2017 22:54 Today I just got my new Fritzbox 6490 (got it for the speed upgrade) and when I was trying to restore the functionality I had before I realized all my port forwardings were no longer working. Well i have an ISP issued router: Fritz!Box 6490 Cable (germany) and i have a ton of Problems with port forwarding. Load balancing, policy based routing, port forwarding, 1:1 NAT and Multiple WAN IP addresses are either not in the UI or not working. Port forwarding fritzbox. ] "parameters" : { ctaHTML += "Lösung noch nicht gefunden? When I port forward for my server, it works for a while, but after 3/4 days people can't join my server anymore. } var clickHandler = function(event) { "action" : "rerender" var handleOpen = function(event) { "eventActions" : [ { "event" : "removeMessageUserEmailSubscription", // If watching, pay attention to key presses, looking for right sequence. "event" : "RevokeSolutionAction", ] floraculix. "event" : "expandMessage", { //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "actions" : [ "action" : "pulsate" }, "actions" : [ "actions" : [ //}); LITHIUM.Dialog({ ] { "action" : "rerender" }, ;(function($) { "selector" : "#messageview", "event" : "editProductMessage", "action" : "rerender" } }, "useTruncatedSubject" : "true", Attached is a screenshot of my configuration. "disableKudosForAnonUser" : "false", }, }, return; { $('#vodafone-community-header').toggle(); "context" : "", "actions" : [ { "event" : "RevokeSolutionAction", { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" var ctaHTML = ''; { { { $('.lia-autocomplete-footer').append(ctaHTML); "event" : "AcceptSolutionAction", "actions" : [ 3 Fai clic sulla scheda "Permit Access ". ] "}); "context" : "envParam:selectedMessage", } "action" : "rerender" }, "event" : "MessagesWidgetEditAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var watching = false; } }, } }, }, { ctaHTML += 'Stell Deine Frage'; "actions" : [ { FRITZ!Box 6490 Cable; FRITZ!Box 5530 Fiber; FRITZ!Box 5491; FRITZ!Box 5490; FRITZ!Box 4040; FRITZ!Box 4020; FRITZ!Box 3490; FRITZ!Box 3390; FRITZ!Box 3370; FRITZ!Box 3272; back to result list . "actions" : [ element.find('li').removeClass('active'); // We're good so far. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, lithadmin: [] "parameters" : { "actions" : [ } "activecastFullscreen" : false, "context" : "", "actions" : [ "action" : "rerender" } "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234516}); { "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { LITHIUM.AjaxSupport.useTickets = false; Box Modelle, z.B. { }, "action" : "rerender" "action" : "rerender" } }); }, { } "event" : "addThreadUserEmailSubscription", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612420}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612466}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1614426}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]);